Structure of PDB 7d1t Chain Z |
>7d1tZ (length=62) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] |
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL VLVVGVLNFFVV |
|
PDB | 7d1t High-resolution cryo-EM structure of photosystem II reveals damage from high-dose electron beams. |
Chain | Z |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
Z |
F17 V25 A28 |
F17 V25 A28 |
|
|
|
|