Structure of PDB 6yhs Chain Z

Receptor sequence
>6yhsZ (length=44) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence]
MKRTFQPSELKRKRVHGFRARMATKAGRQVLARRRAKGRHSLTV
3D structure
PDB6yhs Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
ChainZ
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z M1 R3 T4 F5 Q6 S8 E9 L10 K11 R12 K13 R14 H16 F18 R19 R21 K25 A26 Q29 R33 R34 R35 K37 G38 R39 H40 M1 R3 T4 F5 Q6 S8 E9 L10 K11 R12 K13 R14 H16 F18 R19 R21 K25 A26 Q29 R33 R34 R35 K37 G38 R39 H40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yhs, PDBe:6yhs, PDBj:6yhs
PDBsum6yhs
PubMed32857965
UniProtD0CG06

[Back to BioLiP]