Structure of PDB 6wqq Chain Z

Receptor sequence

>6wqqZ (length=121) Species: 1280 (Staphylococcus aureus)

GYRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLG
KKGDLASRRNAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYT
RILKQGPRRGDGAESVIIELV

3D structure

• PDB: 6wqq Characterization of the Core Ribosomal Binding Region for the Oxazolidone Family of Antibiotics Using Cryo-EM.
• Chain: Z
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	G2 R4 K5 G7 R8 S10 Q12 R13 K14 L20 I30 E31 T33 A35 R36 E39 E45 K46 T49 R59 R60 R67 Q83 R96 G98 G99 T101 R102 R109 R110 G111 D112	G1 R3 K4 G6 R7 S9 Q11 R12 K13 L19 I29 E30 T32 A34 R35 E38 E44 K45 T48 R58 R59 R66 Q82 R95 G97 G98 T100 R101 R108 R109 G110 D111

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6wqq, PDBe:6wqq, PDBj:6wqq
• PDBsum: 6wqq
• PubMed: 32566908
• UniProt: Q2FW33|RL17_STAA8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)