Structure of PDB 6wdg Chain Z

Receptor sequence
>6wdgZ (length=65) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAV
KRHAKKLARENARRT
3D structure
PDB6wdg Cryo-EM of elongating ribosome with EF-Tu•GTP elucidates tRNA proofreading.
ChainZ
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Z R17 E35 Y37 E38 R44 R46 K48 A49 R65 R66 T67 R15 E33 Y35 E36 R42 R44 K46 A47 R63 R64 T65
BS02 rna Z A25 R54 K58 A23 R52 K56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6wdg, PDBe:6wdg, PDBj:6wdg
PDBsum6wdg
PubMed32612237
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]