Structure of PDB 6w1o Chain Z |
>6w1oZ (length=62) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] |
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL VLVVGVLNFFVV |
|
PDB | 6w1o Untangling the sequence of events during the S2→ S3transition in photosystem II and implications for the water oxidation mechanism. |
Chain | Z |
Resolution | 2.08 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
Z |
I21 A28 S29 P30 |
I21 A28 S29 P30 |
|
|
|
|