Structure of PDB 6tnn Chain Z

Receptor sequence
>6tnnZ (length=178) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAID
SAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRG
MDIVIVTTANTDEEARELLTQVGMPFQK
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
ChainZ
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z N37 G39 V40 K71 I74 A75 G76 F77 I85 K120 S121 D123 T129 G131 I132 K133 G151 M152 D153 N36 G38 V39 K70 I73 A74 G75 F76 I84 K119 S120 D122 T128 G130 I131 K132 G150 M151 D152
BS02 rna Z D23 S24 M26 Q27 K64 V66 R69 K88 T90 R92 D22 S23 M25 Q26 K63 V65 R68 K87 T89 R91
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtP12877|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]