Structure of PDB 6swa Chain Z

Receptor sequence

>6swaZ (length=68) Species: 10090 (Mus musculus)

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAVSARA

3D structure

• PDB: 6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.
• Chain: Z
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	A2 K3 K5 N6 H7 T8 T9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 K22 R25 S26 Q27 R28 Y29 L32 D36 K38 F39 N42 M43 R44 F45 A46 K47 K48 H49 N50 K52 G53 L54 K55 M57 Q58 N61	A1 K2 K4 N5 H6 T7 T8 H9 N10 Q11 S12 R13 K14 H16 R17 N18 K21 R24 S25 Q26 R27 Y28 L31 D35 K37 F38 N41 M42 R43 F44 A45 K46 K47 H48 N49 K51 G52 L53 K54 M56 Q57 N60

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6swa, PDBe:6swa, PDBj:6swa
• PDBsum: 6swa
• PubMed: 33357414
• UniProt: P47915|RL29_MOUSE Large ribosomal subunit protein eL29 (Gene Name=Rpl29)