Structure of PDB 6q8y Chain Z

Receptor sequence

>6q8yZ (length=127) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

PDB

6q8y Structure of the 80S ribosome-Xrn1 nuclease complex.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	R18 N24 D25 F27 H29 G35 K36 T38 R41 T43 G45 M46 D51 R52 E54 R84 R90 V121 P122 S123 D124 S125 R127 K129 R132 R133 R135 R136 L137	R8 N14 D15 F17 H19 G25 K26 T28 R31 T33 G35 M36 D41 R42 E44 R74 R80 V111 P112 S113 D114 S115 R117 K119 R122 R123 R125 R126 L127

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6q8y, PDBe:6q8y, PDBj:6q8y
PDBsum	6q8y
PubMed	30911188
UniProt	P39516\|RS14B_YEAST Small ribosomal subunit protein uS11B (Gene Name=RPS14B)