Structure of PDB 6ogg Chain Z

Receptor sequence
>6oggZ (length=65) Species: 562 (Escherichia coli) [Search protein sequence]
IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAV
KRHAKKLARENARRT
3D structure
PDB6ogg Extensive ribosome and RF2 rearrangements during translation termination.
ChainZ
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z R17 R20 F36 E38 R46 S50 R54 A64 R66 T67 R15 R18 F34 E36 R44 S48 R52 A62 R64 T65
BS02 rna Z R20 A25 G26 A29 E30 H55 R18 A23 G24 A27 E28 H53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ogg, PDBe:6ogg, PDBj:6ogg
PDBsum6ogg
PubMed31513010
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]