Structure of PDB 6n8o Chain Z

Receptor sequence

>6n8oZ (length=201) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

RRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVHL
VSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINKM
AWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQQKIIL
SKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIREFPEYF
A

3D structure

PDB

6n8o Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	R4 A6 R7 C8 K13 N14 K15 Y17 Y22 R24 D35 K40 E63 A64 A67 R90 H92 R98 N100 A118 W119 G120 Y157 K158 D193 K198	R2 A4 R5 C6 K11 N12 K13 Y15 Y20 R22 D33 K38 E61 A62 A65 R88 H90 R96 N98 A101 W102 G103 Y140 K141 D176 K181
BS02	rna	Z	Y11 E56 K202 K203 G204 S205 L206	Y9 E54 K185 K186 G187 S188 L189

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n8o, PDBe:6n8o, PDBj:6n8o
PDBsum	6n8o
PubMed	30814529
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]