Structure of PDB 6i7o Chain Z

Receptor sequence

>6i7oZ (length=128) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

NSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYA
AMLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSG
LRIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

PDB

6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.

Chain

Resolution

5.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	R18 N24 D25 F27 H29 G35 K36 E37 T38 R41 T43 G45 M46 K49 A50 D51 R52 E54 R90 P120 V121 P122 S123 D124 S125 T126 R127 K129 G131 R132 R133 R135 R136 L137	R9 N15 D16 F18 H20 G26 K27 E28 T29 R32 T34 G36 M37 K40 A41 D42 R43 E45 R81 P111 V112 P113 S114 D115 S116 T117 R118 K120 G122 R123 R124 R126 R127 L128

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
PDBsum	6i7o
PubMed	30609991
UniProt	P39516\|RS14B_YEAST Small ribosomal subunit protein uS11B (Gene Name=RPS14B)