Structure of PDB 6htq Chain Z |
>6htqZ (length=63) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
MKAGIHPNFKKATVKCACGNEFETGSVKEEVRVEICSECHPFYTGRQKFA SADGRVDRFNKKY |
|
PDB | 6htq Structural Basis for Regulation of the Opposing (p)ppGpp Synthetase and Hydrolase within the Stringent Response Orchestrator Rel. |
Chain | Z |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Z |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|