Structure of PDB 6ha8 Chain Z

Receptor sequence
>6ha8Z (length=58) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVS
HLVSVKEQ
3D structure
PDB6ha8 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
ChainZ
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z R10 S11 I13 G14 R15 P16 E17 V21 T22 T25 L26 G27 K29 K30 T31 N32 H37 N40 A41 A42 G45 M46 R9 S10 I12 G13 R14 P15 E16 V20 T21 T24 L25 G26 K28 K29 T30 N31 H36 N39 A40 A41 G44 M45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ha8, PDBe:6ha8, PDBj:6ha8
PDBsum6ha8
PubMed30126986
UniProtP19947|RL30_BACSU Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]