Structure of PDB 5zji Chain Z

Receptor sequence

>5zjiZ (length=218) Species: 4577 (Zea mays) [Search protein sequence]

SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRE
LEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL
GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDP
LGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHI
ADPVNNNAWAYATNFVPG

3D structure

PDB

5zji Structure of the maize photosystem I supercomplex with light-harvesting complexes I and II.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	Z	W222 A225 V229	W209 A212 V216
BS02	CHL	Z	Y24 L25 Y44 W46	Y11 L12 Y31 W33
BS03	CLA	Z	G42 D43 Y44 D47 S52 F58 N61 R62 E65 R185 M188	G29 D30 Y31 D34 S39 F45 N48 R49 E52 R172 M175
BS04	CLA	Z	L64 H68	L51 H55
BS05	CLA	Z	L74 L77 G78 F81 P82 Q103 Y112 L113	L61 L64 G65 F68 P69 Q90 Y99 L100
BS06	CHL	Z	L118 I119 H120 Q122	L105 I106 H107 Q109
BS07	CHL	Z	W71 I127 Q131	W58 I114 Q118
BS08	CHL	Z	F98 K99 G101 S102 F105 Q131	F85 K86 G88 S89 F92 Q118
BS09	CHL	Z	R70 V138 Y141 R142 G146 P147 L148 G149 F161	R57 V125 Y128 R129 G133 P134 L135 G136 F148
BS10	CHL	Z	L64 I67 H68 W71 M135 G136 E139 R142 I143	L51 I54 H55 W58 M122 G123 E126 R129 I130
BS11	CLA	Z	R70 P157 G158 F161 F173 L176 E180	R57 P144 G145 F148 F160 L163 E167
BS12	CLA	Z	K179 K182 N183 L186	K166 K169 N170 L173
BS13	CLA	Z	K179 N183 L186	K166 N170 L173
BS14	CLA	Z	F189 V196 Q197 V200 T201 N208 H212 N220 A221	F176 V183 Q184 V187 T188 N195 H199 N207 A208
BS15	CLA	Z	L209 H212 P216	L196 H199 P203

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zji, PDBe:5zji, PDBj:5zji
PDBsum	5zji
PubMed	29880686
UniProt	P12329\|CB21_MAIZE Chlorophyll a-b binding protein 1, chloroplastic (Gene Name=CAB1)

[Back to BioLiP]