Structure of PDB 5zeb Chain Z

Receptor sequence
>5zebZ (length=63) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
TTPGELRELTDDELKDKLRESKEELFNLRFQMATGQLSNNRRLRTVRQEI
ARVYTVLRERELG
3D structure
PDB5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
ChainZ
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z M36 S42 N43 N44 R45 R48 R51 Q52 A55 R56 Y58 T59 R62 M32 S38 N39 N40 R41 R44 R47 Q48 A51 R52 Y54 T55 R58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
PDBsum5zeb
PubMed30206241
UniProtA0QSD9|RL29_MYCS2 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]