Structure of PDB 5v0d Chain Z

Receptor sequence

>5v0dZ (length=348) Species: 9606 (Homo sapiens)

GIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEP
TDRYVGFCMKFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANLL
KGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEA
DAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLG
MCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIV
KVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAY
EDDVDPETLSYAGQYVDDSIALQIALGNKDINTFEQIDDYNPDTALYF

3D structure

• PDB: 5v0d Interplay of catalysis, fidelity, threading, and processivity in the exo- and endonucleolytic reactions of human exonuclease I.
• Chain: Z
• Resolution: 2.63 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	Z	K37 I40 A41 F58 R231 G232 I233 G234 A236 K237	K36 I39 A40 F57 R230 G231 I232 G233 A235 K236
BS02	dna	Z	G2 K85 R92 D152 D171 S172 D173 K185 D225	G1 K84 R91 D151 D170 S171 D172 K184 D224
BS03	dna	Z	H36 G79 T81 E89 R92 R93 R96 N333	H35 G78 T80 E88 R91 R92 R95 N332
BS04	MG	Z	D152 D171 D173	D151 D170 D172

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0004518 nuclease activity
• GO:0016788 hydrolase activity, acting on ester bonds
• GO:0035312 5'-3' DNA exonuclease activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:5v0d, PDBe:5v0d, PDBj:5v0d
• PDBsum: 5v0d
• PubMed: 28533382
• UniProt: Q9UQ84|EXO1_HUMAN Exonuclease 1 (Gene Name=EXO1)