Structure of PDB 5uz4 Chain Z

Receptor sequence

>5uz4Z (length=323) Species: 562 (Escherichia coli)

LSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVE
SADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTS
VLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEP
IIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEAL
TGRISIFAGQSGVGKSSLLNALLGLQKEILTNDISDARLYHFPHGGDVID
SPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAV
EEGKIAETRFENYHRILESMAQV

3D structure

• PDB: 5uz4 The cryo-EM structure of YjeQ bound to the 30S subunit suggests a fidelity checkpoint function for this protein in ribosome assembly.
• Chain: Z
• Resolution: 5.8 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	K8 Q10 N17 R47 F48 G49 D53 I66 R67 R68 T69 I70 D111 K117 D241 P268 G269 E272 Y299 R300 D307	K3 Q5 N12 R42 F43 G44 D48 I61 R62 R63 T64 I65 D106 K112 D236 P252 G253 E256 Y283 R284 D291
BS02	GGM	Z	N160 K161 S191 S192 H193 G219 K220 S221 S222 L235 T236 N237 D241	N155 K156 S186 S187 H188 G214 K215 S216 S217 L230 T231 N232 D236

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0019003 GDP binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5uz4, PDBe:5uz4, PDBj:5uz4
• PDBsum: 5uz4
• PubMed: 28396444
• UniProt: P39286|RSGA_ECOLI Small ribosomal subunit biogenesis GTPase RsgA (Gene Name=rsgA)