Structure of PDB 5uyp Chain Z
Receptor sequence
| >5uypZ (length=392) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
| SKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQID NAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDG AILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVE MEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIP EPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKET QKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKP HTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMV MPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVL |
3D structure
| PDB | 5uyp Ensemble cryo-EM elucidates the mechanism of translation fidelity | ||
| Chain | Z | ||
| Resolution | 3.9 Å | ||
| 3D structure |
|
Enzymatic activity
| Catalytic site (original residue number in PDB) | D21 K24 T25 T61 H84 |
| Catalytic site (residue number reindexed from 1) | D21 K24 T25 T61 H84 |
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | Z | G222 R223 G224 T256 R279 | G222 R223 G224 T256 R279 | |
| BS02 | rna | Z | P53 D86 Y87 N90 F218 S219 V226 T228 G257 E259 R262 G275 R288 R318 H319 T320 F323 Y326 R327 Q329 T338 H364 G379 | P53 D86 Y87 N90 F218 S219 V226 T228 G257 E259 R262 G275 R288 R318 H319 T320 F323 Y326 R327 Q329 T338 H364 G379 | |
| BS03 | LYS | Z | H66 T228 E259 M260 F261 N273 V274 G275 | H66 T228 E259 M260 F261 N273 V274 G275 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003723 | RNA binding |
| GO:0003746 | translation elongation factor activity |
| GO:0003924 | GTPase activity |
| GO:0005515 | protein binding |
| GO:0005525 | GTP binding |
| GO:0097216 | guanosine tetraphosphate binding |
