Structure of PDB 5uyn Chain Z

Receptor sequence

>5uynZ (length=392) Species: 83333 (Escherichia coli K-12)

SKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQID
NAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDG
AILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVE
MEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIP
EPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKET
QKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKP
HTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMV
MPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVL

3D structure

• PDB: 5uyn Ensemble cryo-EM elucidates the mechanism of translation fidelity
• Chain: Z
• Resolution: 4.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 K24 T25 T61 H84
• Catalytic site (residue number reindexed from 1): D21 K24 T25 T61 H84

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	G222 R223 G224 T256 R279	G222 R223 G224 T256 R279
BS02	rna	Z	N51 A52 E54 D86 Y87 K89 N90 S219 I220 R223 V226 E259 R262 G275 R283 R288 R318 H319 T320 G325 Y326 R327 Q329 T338 G380	N51 A52 E54 D86 Y87 K89 N90 S219 I220 R223 V226 E259 R262 G275 R283 R288 R318 H319 T320 G325 Y326 R327 Q329 T338 G380

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0032045 guanyl-nucleotide exchange factor complex

External links

• PDB: RCSB:5uyn, PDBe:5uyn, PDBj:5uyn
• PDBsum: 5uyn
• PubMed: 28538735
• UniProt: P0CE47|EFTU1_ECOLI Elongation factor Tu 1 (Gene Name=tufA)