Structure of PDB 5t5h Chain Z

Receptor sequence

>5t5hZ (length=113) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]

GSRRKARRAHFQAPSHVRRILMSAPLSKELRAKYNVRAMPVRKDDEVRVK
RGAYKGREGKVTACYRLRWVIHIDKVNREKANGTTVPVGVHPSNVEITKL
KLNHNRKAILERK

3D structure

PDB

5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.

Chain

Resolution

2.54 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	G7 R9 K11 R13 H16 I26 L27 S29 P31 R37 R43 A44 R57 G58 A59 K61 R84 K86 A87 H97 S99 N100 R118 K119	G1 R3 K5 R7 H10 I20 L21 S23 P25 R31 R37 A38 R51 G52 A53 K55 R78 K80 A81 H91 S93 N94 R112 K113
BS02	rna	Z	R9 R10 R13 R14 F17 Q18 P20 S21 H22 R48 K49 C70 Y71 R72 L73	R3 R4 R7 R8 F11 Q12 P14 S15 H16 R42 K43 C64 Y65 R66 L67

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0015934	large ribosomal subunit

External links