Structure of PDB 5no4 Chain Z

Receptor sequence

>5no4Z (length=313) Species: 83333 (Escherichia coli K-12)

NLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRP
GKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAIL
PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNI
GYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKE
ILTNDISDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQI
TQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRIL
ESMAQVKTRKNFS

3D structure

• PDB: 5no4 RsgA couples the maturation state of the 30S ribosomal decoding center to activation of its GTPase pocket.
• Chain: Z
• Resolution: 5.16 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	N34 R47 F48 G49 M50 H51 I66 R68 Y113 D114 K117 E135 N242 L245 Q247 H248 T251 P268 R271 E272 F273 Y299 R300 D307 R331 R342	N1 R14 F15 G16 M17 H18 I33 R35 Y80 D81 K84 E102 N209 L212 Q214 H215 T218 P235 R238 E239 F240 Y266 R267 D274 R298 R309
BS02	ZN	Z	C297 C302 H304 C310	C264 C269 H271 C277
BS03	GNP	Z	N160 K161 D163 S191 S192 H193 G217 G219 K220 S221 S222 S240 Q247 H248 T249 T250	N127 K128 D130 S158 S159 H160 G184 G186 K187 S188 S189 S207 Q214 H215 T216 T217
BS04	MG	Z	S221 T250	S188 T217

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding

External links

• PDB: RCSB:5no4, PDBe:5no4, PDBj:5no4
• PDBsum: 5no4
• PubMed: 28482099
• UniProt: P39286|RSGA_ECOLI Small ribosomal subunit biogenesis GTPase RsgA (Gene Name=rsgA)