Structure of PDB 5nl0 Chain Z

Receptor sequence
>5nl0Z (length=73) Species: 8355 (Xenopus laevis) [Search protein sequence]
HPKYSDMILAAVQAEKSRSGSSRQSIQKYIKNHYKVGENADSQIKLSIKR
LVTSGALKQTKGVGASGSFRLAK
3D structure
PDB5nl0 Structure and Dynamics of a 197 bp Nucleosome in Complex with Linker Histone H1.
ChainZ
Resolution5.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna Z K27 S46 Q48 S49 Q67 K3 S22 Q24 S25 Q43
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nl0, PDBe:5nl0, PDBj:5nl0
PDBsum5nl0
PubMed28475873
UniProtP22844|H10B_XENLA Histone H1.0-B (Gene Name=h1-0-b)

[Back to BioLiP]