Structure of PDB 5li0 Chain Z

Receptor sequence
>5li0Z (length=82) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
KKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGR
GGDDTLFAKIDGVVKFERKGRDKKQVSVYAVA
3D structure
PDB5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.
ChainZ
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z K13 G14 K19 N20 D23 E25 K27 R28 K32 A34 D35 G36 G42 I44 R47 R49 G50 T51 K52 Y54 G63 K70 F77 K84 K85 K2 G3 K8 N9 D12 E14 K16 R17 K21 A23 D24 G25 G31 I33 R36 R38 G39 T40 K41 Y43 G52 K59 F66 K73 K74
BS02 rna Z R79 K80 G81 R82 R68 K69 G70 R71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5li0, PDBe:5li0, PDBj:5li0
PDBsum5li0
PubMed27906650
UniProtQ2FXT0|RL27_STAA8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]