Structure of PDB 3kzi Chain Z

Receptor sequence
>3kziZ (length=62) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL
VLVVGVLNFFVV
3D structure
PDB3kzi Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
ChainZ
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide Z I21 V25 A28 I21 V25 A28
BS02 CLA Z V20 V23 P24 V20 V23 P24
BS03 BCR Z V54 G55 N58 V54 G55 N58
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0042549 photosystem II stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kzi, PDBe:3kzi, PDBj:3kzi
PDBsum3kzi
PubMed20558739
UniProtQ8DHJ2|PSBZ_THEVB Photosystem II reaction center protein Z (Gene Name=psbZ)

[Back to BioLiP]