Structure of PDB 3jcu Chain Z |
>3jcuZ (length=61) Species: 3562 (Spinacia oleracea) [Search protein sequence] |
TIAFQLAVFALIATSSILLISVPVVFASPDGWSSNKNIVFSGTSLWLGLV FLVGILNSLIS |
|
PDB | 3jcu Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution |
Chain | Z |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
Z |
L20 P24 |
L19 P23 |
|
|
|
|