Structure of PDB 3jbn Chain Z |
>3jbnZ (length=72) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] |
IYIPRKCSATSRLIPAKEHGAVQINVGMVDANGVYNGKTETFAISGHVRQ NGESDACLNRLMYEKKLLSFQN |
|
PDB | 3jbn Dynamical features of the Plasmodium falciparum ribosome during translation. |
Chain | Z |
Resolution | 4.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Z |
H57 Q60 |
H47 Q50 |
|
|
|
|