Structure of PDB 3jb9 Chain Z

Receptor sequence
>3jb9Z (length=80) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
SLCIKLLHETQGHIVTMELENGSTYRGKLIEAEDNMNCQMRDISVTARDG
RVSHLDQVYIRGSHIRFLIVPDMLRNAPMF
3D structure
PDB3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
ChainZ
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Z R27 R49 R62 G63 S64 R26 R48 R61 G62 S63
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0034715 pICln-Sm protein complex
GO:0034719 SMN-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex
GO:0097525 spliceosomal snRNP complex
GO:0097526 spliceosomal tri-snRNP complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
PDBsum3jb9
PubMed26292707
UniProtQ9UUC6|SMD3_SCHPO Small nuclear ribonucleoprotein Sm D3 (Gene Name=smd3)

[Back to BioLiP]