Structure of PDB 3j6b Chain Z

Receptor sequence

>3j6bZ (length=62) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

LMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPA
YSKHLKRLLPYH

3D structure

PDB

3j6b Structure of the yeast mitochondrial large ribosomal subunit.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	L54 M55 K56 T57 H58 K59 K63 R64 R66 K73 R74 I76 A77 G78 R79 K80 H81 G82 N83 I84 S87 H88 R89 K92 T95 R97 H101 A103 Y104 H107 R110 P113 Y114	L1 M2 K3 T4 H5 K6 K10 R11 R13 K20 R21 I23 A24 G25 R26 K27 H28 G29 N30 I31 S34 H35 R36 K39 T42 R44 H48 A50 Y51 H54 R57 P60 Y61

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum	3j6b
PubMed	24675956
UniProt	P53921\|RN35_YEAST Large ribosomal subunit protein bL35m (Gene Name=MRP35)