Structure of PDB 3ccj Chain Z

Receptor sequence

>3ccjZ (length=73) Species: 2238 (Haloarcula marismortui)

SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSY
CDYKFTGGSYKPETPGGKTVRRS

3D structure

• PDB: 3ccj Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
• Chain: Z
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	S34 R37 G39 A40 R41 Y42 G43 R44 V45 R47 C66 R70 R73 T76 Y83 Y93	S1 R4 G6 A7 R8 Y9 G10 R11 V12 R14 C33 R37 R40 T43 Y50 Y60

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3ccj, PDBe:3ccj, PDBj:3ccj
• PDBsum: 3ccj
• PubMed: 18455733
• UniProt: P60619|RL37A_HALMA Large ribosomal subunit protein eL43 (Gene Name=rpl37ae)