Structure of PDB 2xd0 Chain Z

Receptor sequence

>2xd0Z (length=162) Species: 29471 (Pectobacterium atrosepticum) [Search protein sequence]

MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAP
LTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLL
DLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNF
SLLEEKYRDFGK

3D structure

PDB

2xd0 A processed noncoding RNA regulates an altruistic bacterial antiviral system.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	K2 F3 Y29 Q30 N31 T52 S53 P54 K55 E73 N79 L81 L100 L102 M113 Y115 K116 L118 Q119 R122 A123	K2 F3 Y29 Q30 N31 T52 S53 P54 K55 E73 N79 L81 L100 L102 M113 Y115 K116 L118 Q119 R122 A123
BS02	rna	Z	D19 K20 V21 P22 N23 Y29 W57 N60 K62 E63 S67 F88 K127 L138 K143 M144	D19 K20 V21 P22 N23 Y29 W57 N60 K62 E63 S67 F88 K127 L138 K143 M144

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0004519	endonuclease activity
GO:0004521	RNA endonuclease activity
GO:0042802	identical protein binding

	Biological Process
GO:0006276	plasmid maintenance
GO:0045892	negative regulation of DNA-templated transcription
GO:0051607	defense response to virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2xd0, PDBe:2xd0, PDBj:2xd0
PDBsum	2xd0
PubMed	21240270
UniProt	B8X8Z0\|TOXN_PECAT Endoribonuclease ToxN (Gene Name=toxN)

[Back to BioLiP]