Structure of PDB 2wqj Chain Z

Receptor sequence

>2wqjZ (length=31) Species: 9606 (Homo sapiens) [Search protein sequence]

DTYYLQVRGRENFEILMKLKESLELMELVPQ

3D structure

PDB

2wqj Structural Evolution of P53, P63, and P73: Implication for Heterotetramer Formation.

Chain

Resolution

2.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	Z	D353 T354 Y355 Y356	D1 T2 Y3 Y4
BS02	peptide	Z	Y355 Y356 Q358	Y3 Y4 Q6
BS03	peptide	Z	D353 T354 Y355 Y356 L357 Q358 V359 G361 R362 F365 L368 K372 L375 E379	D1 T2 Y3 Y4 L5 Q6 V7 G9 R10 F13 L16 K20 L23 E27
BS04	peptide	Z	K370 S374 M378 V381 Q383	K18 S22 M26 V29 Q31
BS05	peptide	Z	L375 M378 E379	L23 M26 E27

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process
GO:0051262	protein tetramerization

	Cellular Component
GO:0005634	nucleus

External links

PDB	RCSB:2wqj, PDBe:2wqj, PDBj:2wqj
PDBsum	2wqj
PubMed	19815500
UniProt	O15350\|P73_HUMAN Tumor protein p73 (Gene Name=TP73)