Structure of PDB 1yjw Chain Z

Receptor sequence
>1yjwZ (length=73) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSY
CDYKFTGGSYKPETPGGKTVRRS
3D structure
PDB1yjw Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
ChainZ
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z R10 G12 R13 G15 A16 R17 Y18 G19 R20 V21 R23 R46 R49 T52 Y59 Y69 R1 G3 R4 G6 A7 R8 Y9 G10 R11 V12 R14 R37 R40 T43 Y50 Y60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yjw, PDBe:1yjw, PDBj:1yjw
PDBsum1yjw
PubMed15851032
UniProtP60619|RL37A_HALMA Large ribosomal subunit protein eL43 (Gene Name=rpl37ae)

[Back to BioLiP]