Structure of PDB 1nwy Chain Z |
>1nwyZ (length=58) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] |
AKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGY YDGRQVLA |
|
PDB | 1nwy Structural basis for the antibiotic activity of ketolides and azalides. |
Chain | Z |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Z |
H4 P5 S14 H43 |
H3 P4 S13 H42 |
|
|
|
|