Structure of PDB 1h2t Chain Z

Receptor sequence
>1h2tZ (length=146) Species: 9606 (Homo sapiens) [Search protein sequence]
LLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEE
QIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGT
RLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYG
3D structure
PDB1h2t Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
ChainZ
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP Z Y20 R127 V134 Y138 Y16 R123 V130 Y134 PDBbind-CN: -logKd/Ki=7.89,Kd=13nM
BS02 7MG Z Y20 D22 Y43 F83 R112 D114 R123 R127 Q133 V134 Y16 D18 Y39 F79 R108 D110 R119 R123 Q129 V130 PDBbind-CN: -logKd/Ki=7.89,Kd=13nM
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0000340 RNA 7-methylguanosine cap binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0017069 snRNA binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000380 alternative mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0002191 cap-dependent translational initiation
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0006408 snRNA export from nucleus
GO:0006417 regulation of translation
GO:0006446 regulation of translational initiation
GO:0008334 histone mRNA metabolic process
GO:0008380 RNA splicing
GO:0016071 mRNA metabolic process
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031053 primary miRNA processing
GO:0031124 mRNA 3'-end processing
GO:0031442 positive regulation of mRNA 3'-end processing
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035195 miRNA-mediated post-transcriptional gene silencing
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045292 mRNA cis splicing, via spliceosome
GO:0046833 positive regulation of RNA export from nucleus
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005846 nuclear cap binding complex
GO:0034518 RNA cap binding complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h2t, PDBe:1h2t, PDBj:1h2t
PDBsum1h2t
PubMed12374755
UniProtP52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 (Gene Name=NCBP2)

[Back to BioLiP]