Structure of PDB 1ffk Chain Z

Receptor sequence
>1ffkZ (length=92) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDG
KFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
3D structure
PDB1ffk The complete atomic structure of the large ribosomal subunit at 2.4 A resolution.
ChainZ
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z G28 G45 G47 G50 G86 G28 G45 G47 G50 G86
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ffk, PDBe:1ffk, PDBj:1ffk
PDBsum1ffk
PubMed10937989
UniProtP32411|RL44E_HALMA Large ribosomal subunit protein eL42 (Gene Name=rpl44e)

[Back to BioLiP]