Structure of PDB 6t83 Chain Yy

Receptor sequence

>6t83Yy (length=125) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKL

3D structure

PDB

6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Yy	R12 R13 K17 F20 T21 S24 R28 R51 R52 Y74 R75 L76 L111 D112 K113 D114 K116	R11 R12 K16 F19 T20 S23 R27 R50 R51 Y73 R74 L75 L110 D111 K112 D113 K115
BS02	rna	Yy	A2 K3 L6 S9 S10 R12 R16 Y19 K37 K46 R60 G61 S62 K89 V90 N91 H100 S102 K103 R121 K122	A1 K2 L5 S8 S9 R11 R15 Y18 K36 K45 R59 G60 S61 K88 V89 N90 H99 S101 K102 R120 K121

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0032991	protein-containing complex
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6t83, PDBe:6t83, PDBj:6t83
PDBsum	6t83
PubMed	31858614
UniProt	P05743\|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)