Structure of PDB 6ywx Chain YY

Receptor sequence
>6ywxYY (length=99) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]
SVPRARLLQLVKARCELFSTTFNPEGIRTGNKILRQRLKGPALATYYPRK
NVGIRELQKEFGTLGLEVDDEVDDDRLEHLAALRARDKGAPKKKRTAPS
3D structure
PDB6ywx Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
ChainYY
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YY T21 T22 N24 G27 I28 R29 N32 K33 R36 R38 K51 R56 R77 H80 L81 R85 R87 K89 A91 P92 K94 K95 R96 T97 P99 T20 T21 N23 G26 I27 R28 N31 K32 R35 R37 K50 R55 R76 H79 L80 R84 R86 K88 A90 P91 K93 K94 R95 T96 P98
Gene Ontology
Cellular Component
GO:0005739 mitochondrion
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Cellular Component
External links
PDB RCSB:6ywx, PDBe:6ywx, PDBj:6ywx
PDBsum6ywx
PubMed33056988
UniProtQ1K5R0|RT27_NEUCR Small ribosomal subunit protein mS33 (Gene Name=rsm27)

[Back to BioLiP]