Structure of PDB 6ywe Chain YY

Receptor sequence
>6yweYY (length=99) Species: 5141 (Neurospora crassa) [Search protein sequence]
SVPRARLLQLVKARCELFSTTFNPEGIRTGNKILRQRLKGPALATYYPRK
NVGIRELQKEFGTLGLEVDDEVDDDRLEHLAALRARDKGAPKKKRTAPS
3D structure
PDB6ywe Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
ChainYY
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YY T21 T22 N24 R29 T30 N32 K33 R36 R38 K51 R56 R77 R85 R87 K89 A91 P92 K94 K95 R96 T97 P99 T20 T21 N23 R28 T29 N31 K32 R35 R37 K50 R55 R76 R84 R86 K88 A90 P91 K93 K94 R95 T96 P98
External links