Structure of PDB 6o3m Chain YY

Receptor sequence
>6o3mYY (length=107) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVR
VSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCA
KCGGALD
3D structure
PDB6o3m Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
ChainYY
Resolution3.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YY M1 K4 K8 K9 G18 K19 V30 P32 V45 K47 A48 V49 R50 V51 G59 F60 H68 S70 K71 R73 R84 R86 K87 K95 M1 K4 K8 K9 G18 K19 V30 P32 V45 K47 A48 V49 R50 V51 G59 F60 H68 S70 K71 R73 R84 R86 K87 K95
BS02 ZN YY C76 C79 C99 C102 C76 C79 C99 C102
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o3m, PDBe:6o3m, PDBj:6o3m
PDBsum6o3m
PubMed33016876
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]