Structure of PDB 5vpp Chain YY

Receptor sequence
>5vppYY (length=102) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CG
3D structure
PDB5vpp Mechanism of tRNA-mediated +1 ribosomal frameshifting.
ChainYY
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YY R2 K8 K9 G18 K21 V30 P32 Y35 I44 K46 K47 V49 G59 F60 H68 S70 K71 R73 R84 V85 E91 R1 K7 K8 G17 K20 V29 P31 Y34 I43 K45 K46 V48 G58 F59 H67 S69 K70 R72 R83 V84 E90
BS02 MG YY C76 P77 I96 V98 C75 P76 I95 V97
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vpp, PDBe:5vpp, PDBj:5vpp
PDBsum5vpp
PubMed30262649
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]