Structure of PDB 6oj2 Chain YX

Receptor sequence
>6oj2YX (length=92) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
TAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVV
KVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEG
3D structure
PDB6oj2 Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.
ChainYX
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YX S14 K16 K25 T35 K36 T37 E38 N41 E44 K53 N55 T56 H58 R60 K62 K64 R65 L66 Y69 L70 G71 K72 P74 K78 I80 S12 K14 K23 T33 K34 T35 E36 N39 E42 K51 N53 T54 H56 R58 K60 K62 R63 L64 Y67 L68 G69 K70 P72 K76 I78
BS02 MG YX T3 A4 Y5 T1 A2 Y3
BS03 MG YX K25 Y26 T27 K23 Y24 T25
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6oj2, PDBe:6oj2, PDBj:6oj2
PDBsum6oj2
PubMed32601241
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]