Structure of PDB 6bz8 Chain YX

Receptor sequence
>6bz8YX (length=92) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
TAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVV
KVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEG
3D structure
PDB6bz8 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
ChainYX
Resolution3.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YX S14 K16 K25 T35 K36 T37 E38 K40 N41 E44 N55 T56 H58 R60 K62 K63 K64 Y69 G71 K72 P74 D75 K78 S12 K14 K23 T33 K34 T35 E36 K38 N39 E42 N53 T54 H56 R58 K60 K61 K62 Y67 G69 K70 P72 D73 K76
BS02 MG YX K25 Y26 T27 K23 Y24 T25
BS03 MG YX A19 F21 A22 A17 F19 A20
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bz8, PDBe:6bz8, PDBj:6bz8
PDBsum6bz8
PubMed30476222
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]