Structure of PDB 4w4g Chain YX

Receptor sequence
>4w4gYX (length=92) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
TAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVV
KVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEG
3D structure
PDB4w4g Defining the mRNA recognition signature of a bacterial toxin protein.
ChainYX
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YX S14 K16 K25 H31 T35 K36 T37 E38 K40 N41 N55 T56 L57 H58 R60 K62 K63 K64 L66 Y69 L70 G71 K72 R73 P74 K78 I80 S12 K14 K23 H29 T33 K34 T35 E36 K38 N39 N53 T54 L55 H56 R58 K60 K61 K62 L64 Y67 L68 G69 K70 R71 P72 K76 I78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w4g, PDBe:4w4g, PDBj:4w4g
PDBsum4w4g
PubMed26508639
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]