Structure of PDB 6osi Chain YU

Receptor sequence

>6osiYU (length=117) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRK
RRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVR
EPQVFAELVERAKAAQG

3D structure

PDB

6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.

Chain

Resolution

4.14 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YU	P2 R3 A4 K5 T6 G7 V8 R10 R11 K13 H14 K15 K19 K22 G23 Y24 W25 S31 F32 R33 K34 E37 Y45 A46 Y47 H49 R52 R53 K54 R55 F57 R58 R59 W61 I62 N66 R70 N75 Y76 S77 I80 H81 R92 K93 N94	P1 R2 A3 K4 T5 G6 V7 R9 R10 K12 H13 K14 K18 K21 G22 Y23 W24 S30 F31 R32 K33 E36 Y44 A45 Y46 H48 R51 R52 K53 R54 F56 R57 R58 W60 I61 N65 R69 N74 Y75 S76 I79 H80 R91 K92 N93

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum	6osi
PubMed	33016876
UniProt	P60491\|RL20_THET8 Large ribosomal subunit protein bL20 (Gene Name=rplT)