Structure of PDB 6osi Chain YS

Receptor sequence

>6osiYS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

3D structure

• PDB: 6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: YS
• Resolution: 4.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YS	A2 R3 L4 R9 F12 R13 N16 R17 R89 Y94 E111	A1 R2 L3 R8 F11 R12 N15 R16 R88 Y93 E110
BS02	rna	YS	R15 R25 F29 R30 S31 L32 K33 Y36 Q38 G45 V46 T47 S50 L54 G60 N61 K62 T63 Y92 H95 G96 R97	R14 R24 F28 R29 S30 L31 K32 Y35 Q37 G44 V45 T46 S49 L53 G59 N60 K61 T62 Y91 H94 G95 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6osi, PDBe:6osi, PDBj:6osi
• PDBsum: 6osi
• PubMed: 33016876
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)