Structure of PDB 6ope Chain YS

Receptor sequence

>6opeYS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

3D structure

• PDB: 6ope Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.
• Chain: YS
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YS	A2 R3 A6 R9 R10 F12 R13 N16 R17 I18 R23 F87 R89 Y94 E111	A1 R2 A5 R8 R9 F11 R12 N15 R16 I17 R22 F86 R88 Y93 E110
BS02	rna	YS	R15 R25 F29 R30 S31 L32 K33 H34 Y36 G45 V46 T47 N61 K62 T63 K93 H95 R97	R14 R24 F28 R29 S30 L31 K32 H33 Y35 G44 V45 T46 N60 K61 T62 K92 H94 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ope, PDBe:6ope, PDBj:6ope
• PDBsum: 6ope
• PubMed: 32601241
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)