Structure of PDB 8fom Chain YR

Receptor sequence

>8fomYR (length=118) Species: 300852 (Thermus thermophilus HB8)

MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDH
LIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKL
AERRRGDGAPLALVELVE

3D structure

• PDB: 8fom Structural basis for reduced ribosomal A-site fidelity in response to P-site codon-anticodon mismatches.
• Chain: YR
• Resolution: 3.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YR	M1 R2 H3 L4 K5 S6 K9 N11 R12 H13 S14 S15 H16 R17 A19 R22 N23 K26 S27 H31 I34 T35 T36 T37 P39 K40 K42 R45 H50 H53 R57 L60 H61 R63 R64 R68 Q71 R77 R90 Q91 G92 G93 R96 R105 G106 D107	M1 R2 H3 L4 K5 S6 K9 N11 R12 H13 S14 S15 H16 R17 A19 R22 N23 K26 S27 H31 I34 T35 T36 T37 P39 K40 K42 R45 H50 H53 R57 L60 H61 R63 R64 R68 Q71 R77 R90 Q91 G92 G93 R96 R105 G106 D107
BS02	MG	YR	R2 H3 L4 K5	R2 H3 L4 K5

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fom, PDBe:8fom, PDBj:8fom
• PDBsum: 8fom
• PubMed: 36924943
• UniProt: Q9Z9H5|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)