Structure of PDB 6osi Chain YR

Receptor sequence
>6osiYR (length=117) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE
3D structure
PDB6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
ChainYR
Resolution4.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YR R2 H3 L4 R8 K9 N11 R12 H13 S14 H16 R17 N23 I34 T35 T36 T37 K40 K42 H50 H53 H61 R64 L67 Q71 R77 R90 G92 G93 R96 R105 D107 R1 H2 L3 R7 K8 N10 R11 H12 S13 H15 R16 N22 I33 T34 T35 T36 K39 K41 H49 H52 H60 R63 L66 Q70 R76 R89 G91 G92 R95 R104 D106
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum6osi
PubMed33016876
UniProtQ9Z9H5|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)

[Back to BioLiP]