Structure of PDB 6nsh Chain YR

Receptor sequence

>6nshYR (length=117) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE

3D structure

PDB

6nsh Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.

Chain

Resolution

3.397 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YR	R2 H3 L4 K5 S6 R8 K9 N11 R12 H13 S14 H16 R17 L20 R22 N23 K26 H31 I34 T35 T36 P39 K40 K42 R45 D49 H50 H53 R57 L60 H61 R63 R64 L67 R68 Q71 R77 R90 Q91 G92 G93 T95 R96 K99 R104 R105 G106 D107	R1 H2 L3 K4 S5 R7 K8 N10 R11 H12 S13 H15 R16 L19 R21 N22 K25 H30 I33 T34 T35 P38 K39 K41 R44 D48 H49 H52 R56 L59 H60 R62 R63 L66 R67 Q70 R76 R89 Q90 G91 G92 T94 R95 K98 R103 R104 G105 D106

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6nsh, PDBe:6nsh, PDBj:6nsh
PDBsum	6nsh
PubMed	33016876
UniProt	Q9Z9H5\|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)