Structure of PDB 6oj2 Chain YQ

Receptor sequence

>6oj2YQ (length=141) Species: 300852 (Thermus thermophilus HB8)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 6oj2 Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.
• Chain: YQ
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YQ	R51 V52 R56	R51 V52 R56
BS02	rna	YQ	R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 K18 T21 K22 G23 Y26 F29 Q46 A49 R56 K63 F65 R67 F69 D71 Y74 K76 K77 V81 R82 M83 G84 K85 G86 R101 R119 H123 K124 P126 K128	R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 K18 T21 K22 G23 Y26 F29 Q46 A49 R56 K63 F65 R67 F69 D71 Y74 K76 K77 V81 R82 M83 G84 K85 G86 R101 R119 H123 K124 P126 K128
BS03	rna	YQ	R16 L17 G19	R16 L17 G19
BS04	MG	YQ	T21 K98 P99	T21 K98 P99

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6oj2, PDBe:6oj2, PDBj:6oj2
• PDBsum: 6oj2
• PubMed: 32601241
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)